PDB entry 1dvp

View 1dvp on RCSB PDB site
Description: crystal structure of the vhs and fyve tandem domains of hrs, a protein involved in membrane trafficking and signal transduction
Class: transferase
Keywords: HRS, VHS, FYVE, Zinc finger, superhelix, TRANSFERASE
Deposited on 2000-01-21, released 2000-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hepatocyte growth factor-regulated tyrosine kinase substrate
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dvpa1, d1dvpa2
  • Heterogens: ZN, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dvpA (A:)
    mfrssfcknlenatshlrlepdwpsillicdeinqkdvtpknafaaikkkmnspnphssc
    ysllvlesivkncgapvheevftkencemfssflestphenvrqkmlelvqtwayafrss
    dkyqaikdtmtilkakghtfpelreadamftadtapnwadgrvchrcrveftftnrkhhc
    rncgqvfcgqctakqcplpkygiekevrvcdgcfaalqrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvpA (A:)
    mfrssfcknlenatshlrlepdwpsillicdeinqkdvtpknafaaikkkmnspnphssc
    ysllvlesivkncgapvheevftkencemfssflestphenvrqkmlelvqtwayafrss
    dkyqaikdtmtilkakghtfpelremftadtapnwadgrvchrcrveftftnrkhhcrnc
    gqvfcgqctakqcplpkygiekevrvcdgcfaalqrg