PDB entry 1dvo

View 1dvo on RCSB PDB site
Description: the x-ray crystal structure of fino, a repressor of bacterial conjugation
Class: transcription
Keywords: Repressor, Bacterial Conjugation, X-ray Crystallography, TRANSCRIPTION
Deposited on 2000-01-21, released 2000-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fertility inhibition protein o
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29367 (0-151)
    • engineered (91)
  Domains in SCOPe 2.08: d1dvoa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dvoA (A:)
  ppkwkvkkqklaekaareaeltakkaqarqalsiylnlptldeavntlkpwwpglfdgdt
  prllacgirdvlledvaqrniplshkklrramkaitrsesylcamkagacrydtegyvte
  hisqeeevyaaerldkirrqnrikaelqavld