PDB entry 1dvm

View 1dvm on RCSB PDB site
Description: active form of human pai-1
Class: blood clotting
Keywords: serpin, pai-1, inhibitor, blood clotting
Deposited on 2000-01-21, released 2000-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.218
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen activator inhibitor-1
    Species: Homo sapiens [TaxId:9606]
    Gene: UMBILICAL VEIN ENDOTHELIUM LIBRARY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered (149)
      • engineered (153)
      • engineered (318)
      • engineered (353)
    Domains in SCOPe 2.06: d1dvma_
  • Chain 'B':
    Compound: plasminogen activator inhibitor-1
    Species: Homo sapiens [TaxId:9606]
    Gene: UMBILICAL VEIN ENDOTHELIUM LIBRARY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered (149)
      • engineered (153)
      • engineered (318)
      • engineered (353)
    Domains in SCOPe 2.06: d1dvmb_
  • Chain 'C':
    Compound: plasminogen activator inhibitor-1
    Species: Homo sapiens [TaxId:9606]
    Gene: UMBILICAL VEIN ENDOTHELIUM LIBRARY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered (149)
      • engineered (153)
      • engineered (318)
      • engineered (353)
    Domains in SCOPe 2.06: d1dvmc_
  • Chain 'D':
    Compound: plasminogen activator inhibitor-1
    Species: Homo sapiens [TaxId:9606]
    Gene: UMBILICAL VEIN ENDOTHELIUM LIBRARY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered (149)
      • engineered (153)
      • engineered (318)
      • engineered (353)
    Domains in SCOPe 2.06: d1dvmd_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dvmA (A:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvmA (A:)
    ppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
    fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
    vdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdss
    thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
    evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
    adftslsdqeplhvalalqkvkievnesgtvasssavivsarmapeeiiidrpflfvvrh
    nptgtvlfmgqvmep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dvmB (B:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvmB (B:)
    ppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
    fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
    vdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdss
    thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
    evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
    adftslsdqeplhvalalqkvkievnesgtvamapeeiiidrpflfvvrhnptgtvlfmg
    qvmep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dvmC (C:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvmC (C:)
    psyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgf
    kiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqv
    dfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdsst
    hrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyeke
    vplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqa
    dftslsdqeplhvalalqkvkievnesgsarmapeeiiidrpflfvvrhnptgtvlfmgq
    vmep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dvmD (D:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvmD (D:)
    ppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
    fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
    vdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdss
    thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
    evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
    adftslsdqeplhvalalqkvkievnesgtstavivsarmapeeiiidrpflfvvrhnpt
    gtvlfmgqvmep