PDB entry 1dvm

View 1dvm on RCSB PDB site
Description: active form of human pai-1
Deposited on 2000-01-21, released 2000-09-06
The last revision prior to the SCOP 1.57 freeze date was dated 2000-09-06, with a file datestamp of 2000-09-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.218
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1dvma_
  • Chain 'B':
    Domains in SCOP 1.57: d1dvmb_
  • Chain 'C':
    Domains in SCOP 1.57: d1dvmc_
  • Chain 'D':
    Domains in SCOP 1.57: d1dvmd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dvmA (A:)
    ppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
    fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
    vdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdss
    thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
    evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
    adftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvr
    hnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvmA (A:)
    ppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
    fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
    vdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdss
    thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
    evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
    adftslsdqeplhvalalqkvkievnesgtvasssavivsarmapeeiiidrpflfvvrh
    nptgtvlfmgqvmep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dvmB (B:)
    ppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
    fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
    vdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdss
    thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
    evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
    adftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvr
    hnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvmB (B:)
    ppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
    fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
    vdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdss
    thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
    evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
    adftslsdqeplhvalalqkvkievnesgtvamapeeiiidrpflfvvrhnptgtvlfmg
    qvmep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dvmC (C:)
    psyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgf
    kiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqv
    dfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdsst
    hrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyeke
    vplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqa
    dftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrh
    nptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvmC (C:)
    psyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgf
    kiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqv
    dfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdsst
    hrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyeke
    vplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqa
    dftslsdqeplhvalalqkvkievnesgsarmapeeiiidrpflfvvrhnptgtvlfmgq
    vmep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dvmD (D:)
    ppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
    fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
    vdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdss
    thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
    evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
    adftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvr
    hnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvmD (D:)
    ppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamg
    fkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkq
    vdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdss
    thrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyek
    evplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfq
    adftslsdqeplhvalalqkvkievnesgtstavivsarmapeeiiidrpflfvvrhnpt
    gtvlfmgqvmep