PDB entry 1dvk

View 1dvk on RCSB PDB site
Description: crystal structure of the functional domain of the splicing factor prp18
Class: RNA binding protein
Keywords: crystal structure, pre-mRNA Splicing factor, Prp18, X-ray crystallography, RNA BINDING PROTEIN
Deposited on 2000-01-21, released 2000-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.203
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prp18
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33411 (0-End)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d1dvka_
  • Chain 'B':
    Compound: prp18
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33411 (0-End)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d1dvkb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dvkA (A:)
    mriqeaiaqdktisviidpsqigstegkpllsmkcnlyiheilsrwkasleayhpelfld
    tkkalfplllqlrrnqlapdllislatvlyhlqqpkeinlavqsymklsignvawpigvt
    svgiharsahskiqggrnaanimidertrlwitsikrlitfeewytsnhdsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvkA (A:)
    mriqeaiaqdktisviidpsqigstegkpllsmkcnlyiheilsrwkasleayhpelfld
    tkkalfplllqlrrnqlapdllislatvlyhlqqpkeinlavqsymklsignvawpigva
    nimidertrlwitsikrlitfeewytsnh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dvkB (B:)
    mriqeaiaqdktisviidpsqigstegkpllsmkcnlyiheilsrwkasleayhpelfld
    tkkalfplllqlrrnqlapdllislatvlyhlqqpkeinlavqsymklsignvawpigvt
    svgiharsahskiqggrnaanimidertrlwitsikrlitfeewytsnhdsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvkB (B:)
    mriqeaiaqdktisviidpsqigstegkpllsmkcnlyiheilsrwkasleayhpelfld
    tkkalfplllqlrrnqlapdllislatvlyhlqqpkeinlavqsymklsignvawpigvt
    animidertrlwitsikrlitfeewytsnh