PDB entry 1dvj

View 1dvj on RCSB PDB site
Description: crystal structure of orotidine monophosphate decarboxylase complexed with 6-azaump
Class: lyase
Keywords: TIM barrel, dimer, LYASE
Deposited on 2000-03-30, released 2000-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.174
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232 (Start-226)
      • engineered (99)
      • conflict (225)
      • cloning artifact (227-245)
    Domains in SCOPe 2.06: d1dvja1, d1dvja2
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered (99)
    Domains in SCOPe 2.06: d1dvjb_
  • Chain 'C':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232 (Start-226)
      • engineered (99)
      • conflict (225)
      • cloning artifact (227-242)
    Domains in SCOPe 2.06: d1dvjc1, d1dvjc2
  • Chain 'D':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered (99)
    Domains in SCOPe 2.06: d1dvjd_
  • Heterogens: UP6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dvjA (A:)
    rsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrk
    rfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevf
    lltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispg
    vgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllipedpaankarkeae
    laaata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvjA (A:)
    mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
    adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
    pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggd
    pgetlrfadaiivgrsiyladnpaaaaagiiesikdllipedpaankarkeaelaaata
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dvjB (B:)
    rsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrk
    rfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevf
    lltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispg
    vgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllipedpaankarkeae
    laaata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvjB (B:)
    rlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiadfkv
    adipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpgaem
    fiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpgetl
    rfadaiivgrsiyladnpaaaaagiiesikd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dvjC (C:)
    rsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrk
    rfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevf
    lltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispg
    vgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllipedpaankarkeae
    laaata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvjC (C:)
    mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
    adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
    pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggd
    pgetlrfadaiivgrsiyladnpaaaaagiiesikdllipedpaankarkeaelaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dvjD (D:)
    rsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrk
    rfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevf
    lltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispg
    vgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllipedpaankarkeae
    laaata
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvjD (D:)
    mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
    adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
    pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggd
    pgetlrfadaiivgrsiyladnpaaaaagiiesi