PDB entry 1dvg

View 1dvg on RCSB PDB site
Description: crystal structure of rat heme oxygenase-1 in complex with heme; seleleno-methionine derivative, mutated at m51t,m93l,m155l,m191l.
Class: oxidoreductase
Keywords: all alpha, protein-substrate complex
Deposited on 2000-01-20, released 2000-04-12
The last revision prior to the SCOP 1.73 freeze date was dated 2000-04-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heme oxygenase-1
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06762
      • modified residue (33)
      • engineered (50)
      • engineered (92)
      • engineered (154)
      • conflict (165)
      • modified residue (185)
      • engineered (190)
    Domains in SCOP 1.73: d1dvga_
  • Chain 'B':
    Compound: heme oxygenase-1
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06762
      • modified residue (33)
      • engineered (50)
      • engineered (92)
      • engineered (154)
      • conflict (165)
      • modified residue (185)
      • engineered (190)
    Domains in SCOP 1.73: d1dvgb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dvgA (A:)
    merpqldsmsqdlsealkeatkevhiraensefmrnfqkgqvsregfklvtaslyhiyta
    leeeiernkqnpvyaplyfpeelhrraaleqdlafwygphwqeaipytpatqhyvkrlhe
    vggthpellvahaytrylgdlsggqvlkkiaqkalalpssgeglasftfpsidnptkfkq
    lyrarmntleltpevkhrvteeaktafllnielfeelqallteehkdqspsqteflrqrp
    aslvqdttsaetprgksqistsssqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvgA (A:)
    sqdlsealkeatkevhiraensefmrnfqkgqvsregfklvtaslyhiytaleeeiernk
    qnpvyaplyfpeelhrraaleqdlafwygphwqeaipytpatqhyvkrlhevggthpell
    vahaytrylgdlsggqvlkkiaqkalalpssgeglasftfpsidnptkfkqlyrarmntl
    eltpevkhrvteeaktafllnielfeelqallte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dvgB (B:)
    merpqldsmsqdlsealkeatkevhiraensefmrnfqkgqvsregfklvtaslyhiyta
    leeeiernkqnpvyaplyfpeelhrraaleqdlafwygphwqeaipytpatqhyvkrlhe
    vggthpellvahaytrylgdlsggqvlkkiaqkalalpssgeglasftfpsidnptkfkq
    lyrarmntleltpevkhrvteeaktafllnielfeelqallteehkdqspsqteflrqrp
    aslvqdttsaetprgksqistsssqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvgB (B:)
    sqdlsealkeatkevhiraensefmrnfqkgqvsregfklvtaslyhiytaleeeiernk
    qnpvyaplyfpeelhrraaleqdlafwygphwqeaipytpatqhyvkrlhevggthpell
    vahaytrylgdlsggqvlkkiaqkalalpssgeglasftfpsidnptkfkqlyrarmntl
    eltpevkhrvteeaktafllnielfeelqallte