PDB entry 1dvg

View 1dvg on RCSB PDB site
Description: crystal structure of rat heme oxygenase-1 in complex with heme; seleleno-methionine derivative, mutated at m51t,m93l,m155l,m191l.
Deposited on 2000-01-20, released 2000-04-12
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-12, with a file datestamp of 2000-04-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dvga_
  • Chain 'B':
    Domains in SCOP 1.55: d1dvgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dvgA (A:)
    sqdlsealkeatkevhiraensefmrnfqkgqvsregfklvtaslyhiytaleeeiernk
    qnpvyaplyfpeelhrraaleqdlafwygphwqeaipytpatqhyvkrlhevggthpell
    vahaytrylgdlsggqvlkkiaqkalalpssgeglasftfpsidnptkfkqlyrarmntl
    eltpevkhrvteeaktafllnielfeelqallte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dvgB (B:)
    sqdlsealkeatkevhiraensefmrnfqkgqvsregfklvtaslyhiytaleeeiernk
    qnpvyaplyfpeelhrraaleqdlafwygphwqeaipytpatqhyvkrlhevggthpell
    vahaytrylgdlsggqvlkkiaqkalalpssgeglasftfpsidnptkfkqlyrarmntl
    eltpevkhrvteeaktafllnielfeelqallte