PDB entry 1dve

View 1dve on RCSB PDB site
Description: crystal structure of rat heme oxygenase-1 in complex with heme
Class: oxidoreductase
Keywords: all alpha, protein-substrate complex, oxidoreductase
Deposited on 2000-01-20, released 2000-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.214
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heme oxygenase-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dvea_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dveA (A:)
    merpqldsmsqdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiyta
    leeeiernkqnpvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhe
    vggthpellvahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkq
    lyrarmntlemtpevkhrvteeaktafllnielfeelqallteehkdqspsqteflrqrp
    aslvqdttsaetprgksqistsssqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dveA (A:)
    sqdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernk
    qnpvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpell
    vahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntl
    emtpevkhrvteeaktafllnielfeelqallte