PDB entry 1dvd

View 1dvd on RCSB PDB site
Description: solution nmr structure of human stefin a at ph 5.5 and 308k, nmr, 17 structures
Class: thiol protease inhibitor
Keywords: thiol protease inhibitor
Deposited on 1996-02-26, released 1996-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stefin a
    Species: Homo sapiens [TaxId:9606]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dvda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dvdA (A:)
    mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
    dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf