PDB entry 1dvb

View 1dvb on RCSB PDB site
Description: rubrerythrin
Class: electron transport
Keywords: iron, ferroxidase, electron transport
Deposited on 2000-01-20, released 2000-11-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubrerythrin
    Species: Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough [TaxId:882]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1dvba1, d1dvba2
  • Heterogens: FE, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dvbA (A:)
    mkslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrl
    fkfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarv
    fasiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahp
    kahfellginw