PDB entry 1dvb

View 1dvb on RCSB PDB site
Description: rubrerythrin
Deposited on 2000-01-20, released 2000-11-17
The last revision prior to the SCOP 1.57 freeze date was dated 2000-11-17, with a file datestamp of 2000-11-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dvbA (A:)
    mkslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrl
    fkfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarv
    fasiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahp
    kahfellginw