PDB entry 1dv9

View 1dv9 on RCSB PDB site
Description: structural changes accompanying ph-induced dissociation of the b-lactoglobulin dimer
Class: transport protein
Keywords: Beta-lactoglobulin, beta-barrel, low pH structure, triple resonance experiments
Deposited on 2000-01-20, released 2000-02-09
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactoglobulin
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02754 (0-161)
      • see remark 999 (0-1)
      • see remark 999 (104)
    Domains in SCOP 1.75: d1dv9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dv9A (A:)
    ayvtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi