PDB entry 1dv8

View 1dv8 on RCSB PDB site
Description: crystal structure of the carbohydrate recognition domain of the h1 subunit of the asialoglycoprotein receptor
Class: signaling protein
Keywords: C-type lectin CRD, SIGNALING PROTEIN
Deposited on 2000-01-20, released 2000-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: asialoglycoprotein receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dv8a_
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dv8A (A:)
    cpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhigpvntwmg
    lhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnddvcqrpy
    rwvcetel