PDB entry 1dv7

View 1dv7 on RCSB PDB site
Description: crystal structure of orotidine monophosphate decarboxylase
Class: lyase
Keywords: TIM barrel, dimer, LYASE
Deposited on 2000-01-20, released 2000-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232 (0-End)
      • engineered (99)
    Domains in SCOPe 2.06: d1dv7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dv7A (A:)
    rsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrk
    rfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevf
    lltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispg
    vgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dv7A (A:)
    rsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrk
    rfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevf
    lltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispg
    etlrfadaiivgrsiyladnpaaaaagiiesi