PDB entry 1dv7

View 1dv7 on RCSB PDB site
Description: crystal structure of orotidine monophosphate decarboxylase
Deposited on 2000-01-20, released 2000-04-05
The last revision prior to the SCOP 1.71 freeze date was dated 2000-04-05, with a file datestamp of 2000-04-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1dv7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dv7A (A:)
    rsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrk
    rfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevf
    lltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispg
    vgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dv7A (A:)
    rsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrk
    rfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevf
    lltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispg
    etlrfadaiivgrsiyladnpaaaaagiiesi