PDB entry 1dv5

View 1dv5 on RCSB PDB site
Description: tertiary structure of apo-d-alanyl carrier protein
Deposited on 2000-01-19, released 2001-08-01
The last revision prior to the SCOP 1.67 freeze date was dated 2001-08-01, with a file datestamp of 2001-08-01.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1dv5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dv5A (A:)
  adeaikngvldiladltgsddvkknldlnlfetglldsmgtvqlllelqsqfgvdapvse
  fdrkewdtpnkiiakveqaq