PDB entry 1dv4

View 1dv4 on RCSB PDB site
Description: partial structure of 16s RNA of the small ribosomal subunit from thermus thermophilus
Class: ribosome
Keywords: ribosomes, 30s, thermus thermophilus, 16s RNA, ribosome
Deposited on 2000-01-19, released 2000-02-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16S ribosomal RNA
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'E':
    Compound: ribosomal protein s5
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dv4e_
  • Chain 'G':
    Compound: ribosomal protein s7
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dv4g_
  • Heterogens: WO2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dv4E (E:)
    inpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeairka
    iedakknlievpivgttiphevighfgageiilkpasegtgviaggparavlelagisdi
    lsksigsntpinmvratfdglkqlk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dv4G (G:)
    lqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvfkqavenvkp
    rmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriahelmdaaegk
    ggavkkkedvermae