PDB entry 1dv1

View 1dv1 on RCSB PDB site
Description: structure of biotin carboxylase (apo)
Class: ligase
Keywords: ATP-grasp, carboxylase, biotin-dependent, LIGASE
Deposited on 2000-01-19, released 2000-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin carboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dv1a1, d1dv1a2, d1dv1a3
  • Chain 'B':
    Compound: biotin carboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dv1b1, d1dv1b2, d1dv1b3
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dv1A (A:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrgdaelaq
    sismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvv
    eeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvt
    emitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhap
    ggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdl
    qirimndenfqhggtnihylekklglqek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dv1A (A:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikasmrvvrgdaelaqsismtra
    eandmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvveeapapgitpel
    rryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvtemitgvdlikeq
    lriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhapggfgvrweshiy
    agytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdlqirimndenfqh
    ggtnihylekklgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dv1B (B:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrgdaelaq
    sismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvv
    eeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvt
    emitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhap
    ggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdl
    qirimndenfqhggtnihylekklglqek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dv1B (B:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikmrvvrgdaelaqsismtraym
    ekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvveeapapgitpelrryigerc
    akacvdigyrgagtfeflfengefyfiemntriqvehpvtemitgvdlikeqlriaagqp
    lsikqeevhvrghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppy
    ydsmigklicygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihyl
    ekklglqe