PDB entry 1dux

View 1dux on RCSB PDB site
Description: elk-1/DNA structure reveals how residues distal from DNA-binding surface affect DNA-recognition
Class: Transcription/DNA
Keywords: ETS-DOMAIN, DNA-BINDING DOMAIN, WINGED HELIX-TURN-HELIX, CRYSTAL STRUCTURE, DNA-BINDING SPECIFICITY, Transcription/DNA COMPLEX
Deposited on 2000-01-19, released 2000-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.202
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*tp*gp*ap*cp*cp*gp*gp*ap*ap*gp*tp*gp*t)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*ap*cp*ap*cp*tp*tp*cp*cp*gp*gp*tp*cp*a)-3')
  • Chain 'C':
    Compound: ets-domain protein elk-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1duxc_
  • Chain 'D':
    Compound: DNA (5'-d(*tp*gp*ap*cp*cp*gp*gp*ap*ap*gp*tp*gp*t)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*ap*cp*ap*cp*tp*tp*cp*cp*gp*gp*tp*cp*a)-3')
  • Chain 'F':
    Compound: ets-domain protein elk-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1duxf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1duxC (C:)
    mdpsvtlwqfllqllreqgnghiiswtsrdggefklvdaeevarlwglrknktnmnydkl
    sralryyydkniirkvsgqkfvykfvsypevagc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1duxC (C:)
    vtlwqfllqllreqgnghiiswtsrdggefklvdaeevarlwglrknktnmnydklsral
    ryyydkniirkvsgqkfvykfvsype
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1duxF (F:)
    mdpsvtlwqfllqllreqgnghiiswtsrdggefklvdaeevarlwglrknktnmnydkl
    sralryyydkniirkvsgqkfvykfvsypevagc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1duxF (F:)
    vtlwqfllqllreqgnghiiswtsrdggefklvdaeevarlwglrknktnmnydklsral
    ryyydkniirkvsgqkfvykfvsype