PDB entry 1dus

View 1dus on RCSB PDB site
Description: MJ0882-A hypothetical protein from M. jannaschii
Class: structural genomics
Keywords: Hypothetical protein, Methanococcus jannaschii, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center
Deposited on 2000-01-18, released 2000-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: mj0882
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q58292 (0-193)
    • modified residue (78)
    • modified residue (169)
  Domains in SCOPe 2.08: d1dusa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dusA (A:)
  fsekpttksdvkivedilrgkklkfktdsgvfsygkvdkgtkilvenvvvdkdddildlg
  cgygvigialadevksttmadinrraiklakeniklnnldnydirvvhsdlyenvkdrky
  nkiitnppiragkevlhriieegkellkdngeiwvviqtkqgakslakymkdvfgnvetv
  tikggyrvlkskkl