PDB entry 1dur

View 1dur on RCSB PDB site
Description: replacement for 1fdx 2(4fe4s) ferredoxin from (now) peptostreptococcus asaccharolyticus
Class: electron transport
Keywords: TWO 4Fe-4S clusters, ELECTRON TRANSPORT
Deposited on 2000-01-18, released 2000-03-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.155
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2[4fe-4s] ferredoxin
    Species: Peptoniphilus asaccharolyticus [TaxId:1258]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1dura_
  • Heterogens: SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1durA (A:)
    ayvindsciacgackpecpvnciqegsiyaidadscidcgscasvcpvgapnped