PDB entry 1dur

View 1dur on RCSB PDB site
Description: replacement for 1fdx 2(4fe4s) ferredoxin from (now) peptostreptococcus asaccharolyticus
Deposited on 2000-01-18, released 2000-03-24
The last revision prior to the SCOP 1.61 freeze date was dated 2000-12-20, with a file datestamp of 2000-12-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.155
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1dura_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1durA (A:)
    ayvindsciacgackpecpvnciqegsiyaidadscidcgscasvcpvgapnped