PDB entry 1dur

View 1dur on RCSB PDB site
Description: Replacement for 1FDX 2(4FE4S) ferredoxin from (NOW) Peptostreptococcus asaccharolyticus
Class: electron transport
Keywords: TWO 4Fe-4S clusters, ELECTRON TRANSPORT
Deposited on 2000-01-18, released 2000-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2[4fe-4s] ferredoxin
    Species: Peptoniphilus asaccharolyticus [TaxId:1258]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dura_
  • Heterogens: SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1durA (A:)
    ayvindsciacgackpecpvnciqegsiyaidadscidcgscasvcpvgapnped