SCOPe 2.08: Structural Classification of Proteins

PDB entry 1dun

View 1dun on RCSB PDB site
Description: eiav dutpase native
Class: hydrolase
Keywords: hydrolase, dutpase, eiav, trimeric enzyme, aspartyl protease
Deposited on 1997-11-27, released 1998-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
Species: Equine infectious anemia virus [TaxId:11665]
Database cross-references and differences (RAF-indexed):
- Uniprot P11204 (0-End)
Domains in SCOPe 2.08: d1duna_
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1dunA (A:)
mlayqgtqikekrdedagfdlcvpydimipvsdtkiiptdvkiqvppnsfgwvtgkssma
kqgllinggiidegytgeiqvictnigksnikliegqkfaqliilqhhsnsrqpwdenki
sqrgdkgfgstgvf

Sequence, based on observed residues (ATOM records): (download)

>1dunA (A:)
mlayqgtqikekrdedagfdlcvpydimipvsdtkiiptdvkiqvppnsfgwvtgkssma
kqgllinggiidegytgeiqvictnigksnikliegqkfaqliilqhhsnsrqpwdenki