PDB entry 1dul

View 1dul on RCSB PDB site
Description: structure of the ribonucleoprotein core of the e. coli signal recognition particle
Deposited on 2000-01-17, released 2000-02-28
The last revision prior to the SCOP 1.69 freeze date was dated 2003-08-12, with a file datestamp of 2003-08-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1dula_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dulA (A:)
  fdlndfleqkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnrllkqfd
  dmqrmmkkm