PDB entry 1dul

View 1dul on RCSB PDB site
Description: structure of the ribonucleoprotein core of the e. coli signal recognition particle
Class: signaling protein/RNA
Keywords: protein-RNA complex, double helix, tetraloop, internal loop, signal recognition particle, SRP, ribonucleoprotein, SIGNALING PROTEIN/RNA COMPLEX
Deposited on 2000-01-17, released 2000-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition particle protein (fifty-four homolog)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07019 (9-68)
      • insertion (0-8)
      • engineered (14)
      • engineered (21)
      • engineered (23)
      • engineered (44)
      • engineered (46)
      • engineered (61)
      • engineered (64-65)
      • engineered (68)
    Domains in SCOPe 2.07: d1dula_
  • Chain 'B':
    Compound: 4.5 s RNA domain IV
  • Heterogens: K, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dulA (A:)
    fdlndfleqkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnrllkqfd
    dmqrmmkkm
    

  • Chain 'B':
    No sequence available.