PDB entry 1dul

View 1dul on RCSB PDB site
Description: structure of the ribonucleoprotein core of the e. coli signal recognition particle
Class: signaling protein/RNA
Keywords: protein-RNA complex, double helix, tetraloop, internal loop, signal recognition particle, SRP, ribonucleoprotein, SIGNALING PROTEIN-RNA COMPLEX
Deposited on 2000-01-17, released 2000-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-14, with a file datestamp of 2020-10-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: signal recognition particle protein
  Species: Escherichia coli [TaxId:562]
  Gene: FFH
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AGD7
    • engineered mutation (78)
  Domains in SCOPe 2.08: d1dula_
• Chain 'B':
  Compound: 4.5 s RNA domain IV
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Heterogens: K, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1dulA (A:)
  gfdlndfleqlrqmknmggmaslmgklpgmgqipdnvksqmddkvlvrmeaiinsmtmke
  rakpeiikgsrkrriaagsgmqvqdvnrllkqfddmqrmmkkmkk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1dulA (A:)
  fdlndfleqkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnrllkqfd
  dmqrmmkkm
  

  
  
• Chain 'B':
  No sequence available.