PDB entry 1duk

View 1duk on RCSB PDB site
Description: wild-type recombinant sperm whale metaquomyoglobin
Deposited on 2000-01-17, released 2000-02-07
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-14, with a file datestamp of 2000-06-14.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.18
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1duka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dukA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyq