PDB entry 1duj

View 1duj on RCSB PDB site
Description: solution structure of the spindle assembly checkpoint protein human mad2
Class: cell cycle
Keywords: Mad2, spindle assembly checkpoint, CELL CYCLE
Deposited on 2000-01-17, released 2000-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spindle assembly checkpoint protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13257 (2-186)
      • expression artifact (0-1)
    Domains in SCOPe 2.08: d1duja1, d1duja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dujA (A:)
gsitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnnv
veqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreksqkaiqdei
rsvirqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsftt
tihkvns