PDB entry 1dui

View 1dui on RCSB PDB site
Description: Subtilisin BPN' from Bacillus amyloliquefaciens, crystal growth mutant
Class: hydrolase
Keywords: serine protease, hydrolase
Deposited on 2000-01-17, released 2000-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (subtilisin bpn')
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00782 (0-265)
      • engineered (1-2)
      • engineered (4)
      • engineered (42)
      • engineered (49)
      • engineered (73)
      • engineered (196)
      • engineered (207-208)
      • engineered (249)
    Domains in SCOPe 2.07: d1duia_
  • Heterogens: NA, DFP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1duiA (A:)
    akcvsygvsqikapalhsqgytgsnvkvavidsgidsshpdlnvaggasfvpsetnpfqd
    nnshgthvagtvlavapsaslyavkvlgadgsgqyswiingiewaiannmdvinmslggp
    sgsaalkaavdkavasgvvvvaaagnegtsgssstvgypgkypsviavgavdssnqrasf
    ssvgpeldvmapgvsicstlpgnkygaksgtsmasphvagaaalilskhpnwtntqvrss
    lentttklgnsfyygkglinvqaaaq