PDB entry 1dug

View 1dug on RCSB PDB site
Description: structure of the fibrinogen g chain integrin binding and factor xiiia crosslinking sites obtained through carrier protein driven crystallization
Class: transferase, blood clotting
Keywords: gamma chain integrin fragment, carrier protein driven crystallization, transferase, blood clotting
Deposited on 2000-01-17, released 2000-02-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chimera of GLUTATHIONE S-TRANSFERASE-synthetic LINKEr-C-TERMINAL FIBRINOGEN GAMMA CHAIN
    Species: Schistosoma japonicum [TaxId:6182]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08515 (0-216)
      • linker (217-219)
    • Uniprot P02679 (220-233)
    Domains in SCOPe 2.06: d1duga1, d1duga2
  • Chain 'B':
    Compound: chimera of GLUTATHIONE S-TRANSFERASE-synthetic LINKEr-C-TERMINAL FIBRINOGEN GAMMA CHAIN
    Species: Schistosoma japonicum [TaxId:6182]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08515 (0-216)
      • linker (217-219)
    • Uniprot P02679 (220-233)
    Domains in SCOPe 2.06: d1dugb1, d1dugb2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dugA (A:)
    spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
    dvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkvd
    flsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkk
    rieaipqidkylksskyiawplqgwqatfgggdhppksdpqqhhlggakqagdv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dugB (B:)
    spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
    dvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkvd
    flsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkk
    rieaipqidkylksskyiawplqgwqatfgggdhppksdpqqhhlggakqagdv