PDB entry 1dud

View 1dud on RCSB PDB site
Description: deoxyuridine 5'-triphosphate nucleotide hydrolase (d-utpase) complexed with the substrate analogue deoxyuridine 5'-diphosphate (d-udp)
Class: hydrolase
Keywords: hydrolase, nucleotide metabolism, d-utpase, substrate analogue, d-udp complex
Deposited on 1996-04-30, released 1996-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1duda1, d1duda2
  • Heterogens: DUD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dudA (A:)
    mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
    dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
    ifvpvvqaefnlvedfdatdrgeggfghsgrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dudA (A:)
    mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
    dpslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqm
    ifvpvvqaefnlvedf