PDB entry 1duc

View 1duc on RCSB PDB site
Description: eiav dutpase dudp/strontium complex
Class: hydrolase
Keywords: hydrolase, dutpase, eiav, trimeric enzyme, inhibitor complex, aspartyl protease
Deposited on 1997-11-29, released 1998-06-03
The last revision prior to the SCOP 1.75 freeze date was dated 1998-06-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.168
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleoditohydrolase
    Species: Equine infectious anemia virus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1duca_
  • Heterogens: SR, DUD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ducA (A:)
    mlayqgtqikekrdedagfdlcvpydimipvsdtkiiptdvkiqvppnsfgwvtgkssma
    kqgllinggiidegytgeiqvictnigksnikliegqkfaqliilqhhsnsrqpwdenki
    sqrgdkgfgstgvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ducA (A:)
    mlayqgtqikekrdedagfdlcvpydimipvsdtkiiptdvkiqvppnsfgwvtgkssma
    kqgllinggiidegytgeiqvictnigksnikliegqkfaqliilqhhsnsrqpwden