PDB entry 1duc

View 1duc on RCSB PDB site
Description: eiav dutpase dudp/strontium complex
Deposited on 1997-11-29, released 1998-06-03
The last revision prior to the SCOP 1.59 freeze date was dated 1998-06-03, with a file datestamp of 1998-06-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.168
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1duc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1duc_ (-)
    mlayqgtqikekrdedagfdlcvpydimipvsdtkiiptdvkiqvppnsfgwvtgkssma
    kqgllinggiidegytgeiqvictnigksnikliegqkfaqliilqhhsnsrqpwden