PDB entry 1dub

View 1dub on RCSB PDB site
Description: 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5
Deposited on 1996-06-10, released 1997-07-07
The last revision prior to the SCOP 1.57 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1duba_
  • Chain 'B':
    Domains in SCOP 1.57: d1dubb_
  • Chain 'C':
    Domains in SCOP 1.57: d1dubc_
  • Chain 'D':
    Domains in SCOP 1.57: d1dubd_
  • Chain 'E':
    Domains in SCOP 1.57: d1dube_
  • Chain 'F':
    Domains in SCOP 1.57: d1dubf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dubA (A:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
    iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
    kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
    drregmsafvekrkanfkdh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dubB (B:)
    nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
    kafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdi
    iyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvsk
    ifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatdd
    rregmsafvekrkanfkdh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dubC (C:)
    nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
    kafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdi
    iyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvsk
    ifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatdd
    rregmsafvekrkanfkdh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dubD (D:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
    iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
    kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
    drregmsafvekrkanfkdh
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dubE (E:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
    iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
    kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
    drregmsafvekrkanfkdh
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dubF (F:)
    nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
    kafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdi
    iyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvsk
    ifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatdd
    rregmsafvekrkanfkdh