PDB entry 1dub

View 1dub on RCSB PDB site
Description: 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5
Class: lyase
Keywords: beta-oxidation, coa, crotonase, enoyl-coa hydratase, fatty acid metabolism, lyase
Deposited on 1996-06-10, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-enoyl-coa hydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1duba_
  • Chain 'B':
    Compound: 2-enoyl-coa hydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dubb_
  • Chain 'C':
    Compound: 2-enoyl-coa hydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dubc_
  • Chain 'D':
    Compound: 2-enoyl-coa hydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dubd_
  • Chain 'E':
    Compound: 2-enoyl-coa hydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dube_
  • Chain 'F':
    Compound: 2-enoyl-coa hydratase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dubf_
  • Heterogens: CAA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dubA (A:)
    ganfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltg
    gekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammc
    diiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglv
    skifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfat
    ddrregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dubA (A:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
    iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
    kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
    drregmsafvekrkanfkdh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dubB (B:)
    ganfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltg
    gekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammc
    diiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglv
    skifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfat
    ddrregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dubB (B:)
    nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
    kafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdi
    iyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvsk
    ifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatdd
    rregmsafvekrkanfkdh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dubC (C:)
    ganfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltg
    gekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammc
    diiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglv
    skifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfat
    ddrregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dubC (C:)
    nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
    kafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdi
    iyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvsk
    ifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatdd
    rregmsafvekrkanfkdh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dubD (D:)
    ganfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltg
    gekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammc
    diiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglv
    skifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfat
    ddrregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dubD (D:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
    iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
    kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
    drregmsafvekrkanfkdh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1dubE (E:)
    ganfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltg
    gekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammc
    diiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglv
    skifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfat
    ddrregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dubE (E:)
    anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
    ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
    iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
    kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
    drregmsafvekrkanfkdh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1dubF (F:)
    ganfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltg
    gekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammc
    diiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglv
    skifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfat
    ddrregmsafvekrkanfkdh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dubF (F:)
    nfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgge
    kafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdi
    iyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvsk
    ifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatdd
    rregmsafvekrkanfkdh