PDB entry 1du7

View 1du7 on RCSB PDB site
Description: crystal structure of tet repressor class d with 4-epi-tetracycline
Deposited on 2000-01-14, released 2000-03-20
The last revision prior to the SCOP 1.71 freeze date was dated 2000-03-20, with a file datestamp of 2000-03-20.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.227
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1du7A (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du7A (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtadenlppllrealqimdsddgeqaflhgl
    eslirgfevqltallqiv