PDB entry 1du7

View 1du7 on RCSB PDB site
Description: crystal structure of tet repressor class d with 4-epi-tetracycline
Class: transcription/gene regulation
Keywords: transcription regulation, DNA-binding protein, hth-motif, transcription-gene regulation complex
Deposited on 2000-01-14, released 2000-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.227
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (tetracycline repressor protein class d)
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACT4 (0-206)
      • mutation (0)
    Domains in SCOPe 2.07: d1du7a3, d1du7a4
  • Heterogens: CTC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1du7A (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du7A (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtadenlppllrealqimdsddgeqaflhgl
    eslirgfevqltallqiv