PDB entry 1du6

View 1du6 on RCSB PDB site
Description: solution structure of the truncated pbx homeodomain
Class: gene regulation
Keywords: homeodomain, GENE REGULATION
Deposited on 2000-01-14, released 2000-08-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homeobox protein pbx1
    Species: Mus musculus [TaxId:10090]
    Gene: PBX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41778 (10-63)
      • his-tag (0-6)
      • his-tag (8-9)
    Domains in SCOPe 2.08: d1du6a1, d1du6a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1du6A (A:)
    ssghiegrhmnkqateilneyfyshlsnpypseeakeelakkcgitvsqvsnwfgnkrir
    ykkn