PDB entry 1du5

View 1du5 on RCSB PDB site
Description: the crystal structure of zeamatin.
Class: antifungal protein
Keywords: beta sandwich
Deposited on 2000-01-14, released 2000-02-02
The last revision prior to the SCOP 1.73 freeze date was dated 2000-02-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.167
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zeamatin
    Species: Zea mays
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1du5a_
  • Chain 'B':
    Compound: zeamatin
    Species: Zea mays
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1du5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1du5A (A:)
    avftvvnqcpftvwaasvpvgggrqlnrgeswritapagttaariwartgckfdasgrgs
    crtgdcggvlqctgygrapntlaeyalkqfnnldffdislidgfnvpmsflpdggsgcsr
    gprcavdvnarcpaelrqdgvcnnacpvfkkdeyccvgsaandchptnysryfkgqcpda
    ysypkddatstftcpagtnykvvfcp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1du5B (B:)
    avftvvnqcpftvwaasvpvgggrqlnrgeswritapagttaariwartgckfdasgrgs
    crtgdcggvlqctgygrapntlaeyalkqfnnldffdislidgfnvpmsflpdggsgcsr
    gprcavdvnarcpaelrqdgvcnnacpvfkkdeyccvgsaandchptnysryfkgqcpda
    ysypkddatstftcpagtnykvvfcp