PDB entry 1du2

View 1du2 on RCSB PDB site
Description: solution structure of the theta subunit of dna polymerase iii
Deposited on 2000-01-13, released 2000-05-31
The last revision prior to the SCOP 1.57 freeze date was dated 2000-05-31, with a file datestamp of 2000-05-31.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1du2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1du2A (A:)
  mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
  lasvnlsrlpyepklk