PDB entry 1du2

View 1du2 on RCSB PDB site
Description: solution structure of the theta subunit of dna polymerase iii
Deposited on 2000-01-13, released 2000-05-31
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-31, with a file datestamp of 2000-05-31.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1du2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1du2A (A:)
    mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
    lasvnlsrlpyepklk