PDB entry 1du2

View 1du2 on RCSB PDB site
Description: solution structure of the theta subunit of DNA polymerase III
Class: transferase
Keywords: DNA polymerase, Alpha Helix, TRANSFERASE
Deposited on 2000-01-13, released 2000-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase III
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1du2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1du2A (A:)
    mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
    lasvnlsrlpyepklk