PDB entry 1du2

View 1du2 on RCSB PDB site
Description: solution structure of the theta subunit of DNA polymerase III
Class: transferase
Keywords: DNA polymerase, Alpha Helix, TRANSFERASE
Deposited on 2000-01-13, released 2000-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA polymerase III
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABS8 (0-75)
  Domains in SCOPe 2.08: d1du2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1du2A (A:)
  mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
  lasvnlsrlpyepklk