PDB entry 1du0

View 1du0 on RCSB PDB site
Description: engrailed homeodomain q50a variant dna complex
Deposited on 2000-01-13, released 2000-07-31
The last revision prior to the SCOP 1.59 freeze date was dated 2000-08-07, with a file datestamp of 2000-08-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1du0a_
  • Chain 'B':
    Domains in SCOP 1.59: d1du0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1du0A (A:)
afsseqlarlkrefnenrylterrrqqlsselglneaqikiwfankrakikks

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1du0B (B:)
rprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfankrakikk