PDB entry 1dtx

View 1dtx on RCSB PDB site
Description: crystal structure of alpha-dendrotoxin from the green mamba venom and its comparison with the structure of bovine pancreatic trypsin inhibitor
Deposited on 1991-04-29, released 1992-01-15
The last revision prior to the SCOP 1.65 freeze date was dated 1992-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.169
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1dtx__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dtx_ (-)
    eprrklcilhrnpgrcydkipafyynqkkkqcerfdwsgcggnsnrfktieecrrtcig