PDB entry 1dtx

View 1dtx on RCSB PDB site
Description: crystal structure of alpha-dendrotoxin from the green mamba venom and its comparison with the structure of bovine pancreatic trypsin inhibitor
Class: presynaptic neurotoxin
Keywords: presynaptic neurotoxin
Deposited on 1991-04-29, released 1992-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha-dendrotoxin
  Species: Dendroaspis angusticeps [TaxId:8618]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00980 (1-58)
  Domains in SCOPe 2.08: d1dtxa_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dtxA (A:)
  eprrklcilhrnpgrcydkipafyynqkkkqcerfdwsgcggnsnrfktieecrrtcig