PDB entry 1dtw

View 1dtw on RCSB PDB site
Description: human branched-chain alpha-keto acid dehydrogenase
Deposited on 2000-01-13, released 2000-03-27
The last revision prior to the SCOP 1.67 freeze date was dated 2000-03-27, with a file datestamp of 2000-03-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.224
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dtwA (A:)
    sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlkl
    yksmtllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlm
    yrdyplelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakr
    ananrvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgia
    argpgygimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssay
    rsvdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnp
    nllfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dtwA (A:)
    pqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmtl
    lntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdypl
    elfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananrv
    vicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpgy
    gimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssayrhpisr
    lrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyqempaqlrkq
    qeslarhlqtygehypldhfdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dtwB (B:)
    vahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvgl
    rdkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryr
    sgdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscie
    dknpciffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasm
    akeklgvscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecf
    lnleapisrvcgydtpfphifepfyipdkwkcydalrkminy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dtwB (B:)
    qtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygkdrvfntplce
    qgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfncgsltirspw
    gcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpciffepkilyra
    aaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrt
    iipwdvdticksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtp
    fphifepfyipdkwkcydalrkminy