PDB entry 1dtv

View 1dtv on RCSB PDB site
Description: nmr structure of the leech carboxypeptidase inhibitor (lci)
Class: hydrolase inhibitor
Keywords: Leech Carboxypeptidase Inhibitor, LCI, HYDROLASE INHIBITOR
Deposited on 2000-01-13, released 2000-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: carboxypeptidase inhibitor
  Species: Hirudo medicinalis [TaxId:6421]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81511 (0-66)
    • conflict (0)
  Domains in SCOPe 2.08: d1dtva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dtvA (A:)
  gshtpdesflcyqpdqvccficrgaaplpsegecnphptapwcregavewvpystgqcrt
  tcipyve