PDB entry 1dtt

View 1dtt on RCSB PDB site
Description: crystal structure of hiv-1 reverse transcriptase in complex with pett-2 (pett130a94)
Class: hydrolase/transferase
Keywords: HIV-1 reverse transcriptase AIDS, non-nucleoside inhibitor, drug design, HYDROLASE-TRANSFERASE COMPLEX
Deposited on 2000-01-13, released 2000-04-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.199
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 rt a-chain
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dtta1, d1dtta2
  • Chain 'B':
    Compound: hiv-1 rt b-chain
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dttb_
  • Heterogens: FTC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dttA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dttA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyq
    ymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvq
    pivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaele
    laenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgaht
    ndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntppl
    vklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqai
    ylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgi
    g
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dttB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dttB (B:)
    ietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaik
    kkdstkwrklvdfrelnkrtqdfwlgiphpaglkkkksvtvldvgdayfsvpldedfrky
    taftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddl
    yvgsdleigqhrtkieelrqhllrwglttpgyelhpdkwtvqpivlpekdswtvndiqkl
    vgklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyyd
    pskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesi
    viwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyqleke