PDB entry 1dts

View 1dts on RCSB PDB site
Description: crystal structure of an ATP dependent carboxylase, dethiobiotin synthase, at 1.65 angstroms resolution
Class: cyclo-ligase
Keywords: cyclo-ligase
Deposited on 1995-03-28, released 1995-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.169
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dethiobiotin synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dtsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dtsA (A:)
    mskryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalq
    rnsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegagg
    wftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtp
    pgkrhaeymttltrmipapllgeipwlaeaatgkyinlall
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dtsA (A:)
    skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
    nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
    ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
    gkrhaeymttltrmipapllgeipwlaeaatgkyinlall